• Gene id: 83639

Gene Summary

• Gene Symbol: TEX101   Gene   UCSC   Ensembl
• Aliases: CT131, GTPR867, NYD-SP8, PRO1884, SGRG, SPATA44, TES101RP
• Gene name: testis expressed 101
• Alternate names: testis-expressed protein 101, TES101-reactive protein, cancer/testis antigen 131, cell surface receptor NYD-SP8, scleroderma-associated autoantigen, spermatogenesis associated 44, spermatogenesis-related gene protein, testis expressed sequence 101, testis-expres,
• Gene location: 19q13.31 (43388610: 43418614)     Exons: 10     NC_000019.10
• OMIM: 612665

SNPs

rs35033974

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.43416460G>T
NC_000019.9   g.43920612G>T
NM_031451.4   c.350G>T
XM_005259303.3   c.464G>T
XM_005259303.1   c.392G>T
NM_001130011.1   c.296G>T
NM_001130011.3   c.296G>T
NM_001130011.2   c.296G>T
NP_113639.4   p.Gly117Val
XP_005259360.2   p.Gly155Val
NP_00  

Protein Summary

• Protein general information: Q9BY14  
  • Name: Testis expressed protein 101 (Cell surface receptor NYD SP8) (Scleroderma associated autoantigen) (Spermatogenesis related gene protein)
  • Length: 249  
  • Mass: 26667
  • Tissue specificity: Detected in testis and spermatogonia. Not detected in spermatocytes. Detected in blood leukocytes. {ECO
• Sequence:

  MGTPRIQHLLILLVLGASLLTSGLELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAI
  LATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETTASTVSTTLHCPTCVALGTCF
  SAPSLPCPNGTTRCYQGKLEITGGGIESSVEVKGCTAMIGCRLMSGILAVGPMFVREACPHQLLTQPRKTENGAT
  CLPIPVWGLQLLLPLLLPSFIHFS

• Structural information:
  • Protein Domains: (140..21-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR016054  
  • STRING: ENSP00000472308
• Other Databases: GeneCards:  TEX101  Malacards:  TEX101

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002080	acrosomal membrane	IEA	cellular component
GO:0002696	positive regulation of leukocyte activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0002080	acrosomal membrane	IEA	cellular component
GO:0002696	positive regulation of leukocyte activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:1901317	regulation of flagellated sperm motility	IBA	biological process
GO:0046658	anchored component of plasma membrane	IBA	cellular component
GO:0044853	plasma membrane raft	IBA	cellular component
GO:0007339	binding of sperm to zona pellucida	IBA	biological process
GO:0009566	fertilization	ISS	biological process
GO:1901317	regulation of flagellated sperm motility	ISS	biological process
GO:0005576	extracellular region	ISS	cellular component
GO:0046658	anchored component of plasma membrane	ISS	cellular component
GO:0030317	flagellated sperm motility	ISS	biological process
GO:0007339	binding of sperm to zona pellucida	ISS	biological process
GO:0001669	acrosomal vesicle	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0002080	acrosomal membrane	IEA	cellular component
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:1901317	regulation of flagellated sperm motility	IEA	biological process
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0009566	fertilization	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0001669	acrosomal vesicle	IEA	cellular component

Diseases

Associated diseases	References
Azoospermia	MIK: 24259048
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 24259048
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 27005865
Male infertility	MIK: 15689535
Teratozoospermia	MIK: 17327269
Oligozoospermia	MIK: 28330469
Sertoli cell-only syndrome	MIK: 28330469
Obstructive azoospermia	MIK: 28330469

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24259048	Azoospermia			199 seminal plasma samples from men with normal spermatogenesis and azoospermia	Male infertility
16516155	May regulate speramtocyte migration through breakdown of extracellular matrix protein barriers in spermatogenesis				Male infertility
15689535	May play an important physiological role in germ cell development				Male infertility
28330469	Unexplained infertility, oligospermia, azoospermia, Sertoli cell-only syndrome, obstructive azoospermia, Male infertility			854 (64 fertile pre-vasectomy men, 277 unexplained infertility, 270 oligospermia, 137 azoospermia, 57 Fertile post-vasectomy men, 13 sertoli cell only syndrome)	Male infertility
27005865	Important for fertile spermatozoa, Male infertility				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq