• Gene id: 83591

Gene Summary

• Gene Symbol: THAP2   Gene   UCSC   Ensembl
• Gene name: THAP domain containing 2
• Alternate names: THAP domain-containing protein 2, THAP domain containing, apoptosis associated protein 2,
• Gene location: 12q21.1 (71664300: 71680643)     Exons: 3     NC_000012.12

Protein Summary

• Protein general information: Q9H0W7  
  • Name: THAP domain containing protein 2
  • Length: 228  
  • Mass: 26260
• Sequence:

  MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEASCFDLTGQTRRLKMDA
  VPTIFDFCTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRR
  KMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKS
  TFI

• Structural information:
  • Interpro: IPR026521  IPR006612  IPR038441  
  • Prosite: PS50950
  • PDB: 2D8R
  • PDBsum: 2D8R
  • STRING: ENSP00000310796
• Other Databases: GeneCards:  THAP2  Malacards:  THAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R