• Gene id: 83482

Gene Summary

• Gene Symbol: SCRT1   Gene   UCSC   Ensembl
• Aliases: SCRT, ZNF898
• Gene name: scratch family transcriptional repressor 1
• Alternate names: transcriptional repressor scratch 1, scratch family zinc finger 1, scratch homolog 1, zinc finger protein,
• Gene location: 8q24.3 (149028504: 149003050)     Exons: 11     NC_000007.14
• Gene summary(Entrez): This gene encodes a C2H2-type zinc finger transcriptional repressor that binds to E-box motifs. The encoded protein may promote neural differention and may be involved in cancers with neuroendocrine features. [provided by RefSeq, Jul 2013]
• OMIM: 605858

Protein Summary

• Protein general information: Q9BWW7  
  • Name: Transcriptional repressor scratch 1 (Scratch homolog 1 zinc finger protein) (SCRT) (Scratch 1) (hScrt)
  • Length: 348  
  • Mass: 35570
  • Tissue specificity: Brain specific. {ECO
• Sequence:

  MPRSFLVKKVKLDAFSSADLESAYGRARSDLGAPLHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRG
  ELGPAAAGSAPPPTPRPELATAAGGYINGDAAVSEGYAADAFFITDGRSRRKASNAGSAAAPSTASAAAPDGDAG
  GGGGAGGRSLGSGPGGRGGTRAGAGTEARAGPGAAGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCP
  TCGKVYVSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSA
  FKHFQCKRCKKSFALKSYLNKHYESACFKGGAGGPAAPAPPQLSPVQA

• Structural information:
  • Interpro: IPR029794  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000455711
• Other Databases: GeneCards:  SCRT1  Malacards:  SCRT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:2001222	regulation of neuron migration	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)