• Gene id: 83447

Gene Summary

• Gene Symbol: SLC25A31   Gene   UCSC   Ensembl
• Aliases: AAC4, ANT 4, ANT4, SFEC35kDa
• Gene name: solute carrier family 25 member 31
• Alternate names: ADP/ATP translocase 4, ADP,ATP carrier protein 4, adenine nucleotide translocase 4, adenine nucleotide translocator 4, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31, sperm flagellar energy carrier protein,
• Gene location: 4q28.1 (127730371: 127774298)     Exons: 7     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the ADP/ATP carrier family of proteins that exchange cytosolic ADP for matrix ATP in the mitochondria. Cells over-expressing this gene have been shown to display an anti-apoptotic phenotype. This protein is
• OMIM: 611625

Protein Summary

• Protein general information: Q9H0C2  
  • Name: ADP/ATP translocase 4 (ADP,ATP carrier protein 4) (Adenine nucleotide translocator 4) (ANT 4) (Solute carrier family 25 member 31) (Sperm flagellar energy carrier protein)
  • Length: 315  
  • Mass: 35022
  • Tissue specificity: Expressed in brain, liver, sperm and testis. {ECO
• Sequence:

  MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIPR
  EQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFAR
  TRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKKTPFLVS
  FFIAQVVTTCSGILSYPFDTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVL
  YDKIKEFFHIDIGGR

• Structural information:
  • Interpro: IPR002113  IPR002067  IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000281154
• Other Databases: GeneCards:  SLC25A31  Malacards:  SLC25A31

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005471	ATP:ADP antiporter activity	IBA	molecular function
GO:0005347	ATP transmembrane transporter activity	IEA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031514	motile cilium	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0015867	ATP transport	IEA	biological process
GO:0015867	ATP transport	IEA	biological process
GO:0015866	ADP transport	IEA	biological process
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa05166	Human T-cell leukemia virus 1 infection
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04217	Necroptosis
hsa05164	Influenza A
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray