Search Result
| Gene id | 83417 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | FCRL4 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CD307d, FCRH4, IGFP2, IRTA1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | Fc receptor like 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | Fc receptor-like protein 4, IFGP family protein 2, fc receptor homolog 4, fcR-like protein 4, hIFGP2, immune receptor translocation-associated protein 1, immunoglobulin superfamily Fc receptor, gp42, immunoglobulin superfamily receptor translocation associated 1, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
1q23.1 (157598084: 157573746) Exons: 9 NC_000001.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembran |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 605876 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs868256749 Strand: Allele origin: Allele change: Mutation type: snv NC_000012.12 g.63617303C>T NC_000012.11 g.64011083C>T NG_031909.1 g.56272G>A|SEQ=[C/T]|GENE=DPY19L2 rs751879424 Strand: Allele origin: Allele change: Mutation type: del NC_000012.12 g.63617339del NC_000012.11 g.64011119del NG_031909.1 g.56236del NM_173812.4 c.1183del NM_173812.5 c.1183del XM_011538218.3 c.172del XR_001748666.2 n.1335del XM_006719352.2 c.754del XM_017019192.2 c.1033del XM_017019203.2 c.238del XM_0170 rs587777206 Strand: Allele origin: Allele change: Mutation type: snv NC_000012.12 g.63624101G>A NC_000012.11 g.64017881G>A NG_031909.1 g.49474C>T NM_173812.4 c.892C>T NM_173812.5 c.892C>T XR_001748666.2 n.1044C>T XM_006719352.2 c.463C>T XM_017019193.2 c.589C>T XM_011538215.2 c.379C>T XR_002957317.1 n.1044C>T XR_002957 rs587777205 Strand: Allele origin: Allele change: Mutation type: snv NC_000012.12 g.63569312T>A NC_000012.12 g.63569312T>G NC_000012.11 g.63963092T>A NC_000012.11 g.63963092T>G NG_031909.1 g.104263A>T NG_031909.1 g.104263A>C NM_173812.4 c.2038A>T NM_173812.4 c.2038A>C NM_173812.5 c.2038A>T NM_173812.5 c.2038A>C XM_011 rs147579680 Strand: Allele origin: Allele change: Mutation type: snv NC_000012.12 g.63624124C>T NC_000012.11 g.64017904C>T NG_031909.1 g.49451G>A NM_173812.4 c.869G>A NM_173812.5 c.869G>A XR_001748666.2 n.1021G>A XM_006719352.2 c.440G>A XM_017019193.2 c.566G>A XM_011538215.2 c.356G>A XR_002957317.1 n.1021G>A XR_002957 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q96PJ5 Name: Fc receptor like protein 4 (FcR like protein 4) (FcRL4) (Fc receptor homolog 4) (FcRH4) (IFGP family protein 2) (hIFGP2) (Immune receptor translocation associated protein 1) (CD antigen CD307d) Length: 515 Mass: 57224 Tissue specificity: Specifically expressed by memory and monocytoid B-cells which populate spleen and lymph nodes. Preferentially expressed in memory B-cells associated with mucosal tissue (at protein level). {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTL EVRESGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWNGNILSISNKSW DLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPL HFNFFRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQA VEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVLNV TVRETPGNRDGLVAAGATGGLLSALLLAVALLFHCWRRRKSGVGFLGDETRLPPAPGPGESSHSICPAQVELQSL YVDVHPKKGDLVYSEIQTTQLGEEEEANTSRTLLEDKDVSVVYSEVKTQHPDNSAGKISSKDEES | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: FCRL4  Malacards: FCRL4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||