Search Result
| Gene id | 828 | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | CAPS Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CAPS1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | calcyphosine | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | calcyphosin, calcyphosine 1, epididymis secretory sperm binding protein, thyroid protein p24, | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
19p13.3 (5914253: 5916210) Exons: 11 NC_000019.10 |
||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alterna |
||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 114212 | ||||||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs2231599 Strand: Allele origin: Allele change: Mutation type: snv NC_000001.11 g.86574546A>G NC_000001.10 g.87040229A>G NM_012128.4 c.1474A>G NM_012128.3 c.1474A>G XM_011541015.2 c.1321A>G NR_024602.1 n.1409A>G NR_024602.2 n.1407A>G NP_036260.2 p.Ser492Gly XP_011539317.1 p.Ser441Gly|SEQ=[A/G]|GENE=CLCA4 CLCA4 rs759981524 Strand: Allele origin: Allele change: Mutation type: snv NC_000001.11 g.86579956A>C NC_000001.11 g.86579956A>G NC_000001.11 g.86579956A>T NC_000001.10 g.87045639A>C NC_000001.10 g.87045639A>G NC_000001.10 g.87045639A>T NM_012128.4 c.2371A>C NM_012128.4 c.2371A>G NM_012128.4 c.2371A>T NM_012128.3 c.2371A>C rs757773924 Strand: Allele origin: Allele change: Mutation type: snv NC_000001.11 g.86578055C>G NC_000001.11 g.86578055C>T NC_000001.10 g.87043738C>G NC_000001.10 g.87043738C>T NM_012128.4 c.2105C>G NM_012128.4 c.2105C>T NM_012128.3 c.2105C>G NM_012128.3 c.2105C>T XM_011541015.2 c.1952C>G XM_011541015.2 c.1952C>T NR_0 |
||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q13938 Name: Calcyphosin (Calcyphosine) Length: 275 Mass: 30240 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MQCHRDLALSQALWGWQLSKQSGWAHPSLPHSPLPSTVHSCSWAPPHLQRHLPLATVSPGTTQLTQGPAGRTLGQ TQASCPEPRPSMDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEG VCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDE VLRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL | ||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CAPS  Malacards: CAPS | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||