• Gene id: 8269

Gene Summary

• Gene Symbol: TMEM187   Gene   UCSC   Ensembl
• Aliases: CXorf12, DXS9878E, ITBA1
• Gene name: transmembrane protein 187
• Alternate names: transmembrane protein 187,
• Gene location: Xq28 (153972753: 153983193)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene consists of two exons and encodes a multi-pass membrane protein. An alternatively spliced transcript variant encoding the same protein has been found, but its biological validity is not determined. [provided by RefSeq, May 2010]
• OMIM: 604463

Protein Summary

• Protein general information: Q14656  
  • Name: Transmembrane protein 187 (Protein ITBA1)
  • Length: 261  
  • Mass: 29148
  • Tissue specificity: Ubiquitous.
• Sequence:

  MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLVNMAYTLLGLSWLHRG
  GAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTLPIFAWPVAWCLYLDRGWRPWLFLSLECVSL
  ASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTG
  HFWSKVCDVLQFHFAFLFLTHFNTHPRFHPSGGKTR

• Structural information:
  • Interpro: IPR028066  
  • STRING: ENSP00000358999
• Other Databases: GeneCards:  TMEM187  Malacards:  TMEM187

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0030133	transport vesicle	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030133	transport vesicle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881