• Gene id: 81926

Gene Summary

• Gene Symbol: ABHD17A   Gene   UCSC   Ensembl
• Aliases: C19orf27, FAM108A1
• Gene name: abhydrolase domain containing 17A, depalmitoylase
• Alternate names: alpha/beta hydrolase domain-containing protein 17A, abhydrolase domain containing 17A, abhydrolase domain-containing protein 17A, abhydrolase domain-containing protein FAM108A1, family with sequence similarity 108, member A1, protein ABHD17A,
• Gene location: 19p13.3 (1885518: 1876809)     Exons: 7     NC_000019.10
• OMIM: 604638

Protein Summary

• Protein general information: Q96GS6  
  • Name: Alpha/beta hydrolase domain containing protein 17A (Abhydrolase domain containing protein 17A) (EC 3.1.2.22)
  • Length: 310  
  • Mass: 33990
• Sequence:

  MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGAAPLGTLRASSGAPGRWKLHLTERAD
  FQYSQRELDTIEVFPTKSARGNRVSCMYVRCVPGARYTVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGY
  GASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDT
  KKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRF
  ISQELPSQRA

• Structural information:
  • Interpro: IPR029058  IPR022742  
• Other Databases: GeneCards:  ABHD17A  Malacards:  ABHD17A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002084	protein depalmitoylation	IBA	biological process
GO:0099175	regulation of postsynapse organization	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0008474	palmitoyl-(protein) hydrolase activity	IBA	molecular function
GO:0010008	endosome membrane	IBA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0008474	palmitoyl-(protein) hydrolase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902817	negative regulation of protein localization to microtubule	IEA	biological process
GO:0099175	regulation of postsynapse organization	IEA	biological process
GO:0099031	anchored component of postsynaptic density membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0002084	protein depalmitoylation	IEA	biological process
GO:1905668	positive regulation of protein localization to endosome	IEA	biological process
GO:0099033	anchored component of postsynaptic recycling endosome membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0008474	palmitoyl-(protein) hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0008474	palmitoyl-(protein) hydrolase activity	IMP	molecular function
GO:0072657	protein localization to membrane	IMP	biological process
GO:0018345	protein palmitoylation	IMP	biological process
GO:0018345	protein palmitoylation	IGI	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq