• Gene id: 81855

Gene Summary

• Gene Symbol: SFXN3   Gene   UCSC   Ensembl
• Aliases: BA108L7.2, SFX3, SLC56A3
• Gene name: sideroflexin 3
• Alternate names: sideroflexin-3,
• Gene location: 10q24.31 (101031233: 101041242)     Exons: 12     NC_000010.11
• OMIM: 615571

Protein Summary

• Protein general information: Q9BWM7  
  • Name: Sideroflexin 3
  • Length: 321  
  • Mass: 35503
• Sequence:

  MGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYD
  SAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTPITVRQLGTAY
  VSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPVADEAGQRLGYSVTAAKQGI
  FQVVISRICMAIPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATPLCCALFPQKSSIHISNLEPE
  LRAQIHEQNPSVEVVYYNKGL

• Structural information:
  • Interpro: IPR004686  
  • STRING: ENSP00000224807
• Other Databases: GeneCards:  SFXN3  Malacards:  SFXN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031305	integral component of mitochondrial inner membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0022889	serine transmembrane transporter activity	IBA	molecular function
GO:0140300	serine import into mitochondrion	IBA	biological process
GO:1990542	mitochondrial transmembrane transport	IBA	biological process
GO:0006730	one-carbon metabolic process	IDA	biological process
GO:1990542	mitochondrial transmembrane transport	IDA	biological process
GO:0022889	serine transmembrane transporter activity	IDA	molecular function
GO:0140300	serine import into mitochondrion	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015075	ion transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006730	one-carbon metabolic process	IEA	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881