• Gene id: 81833

Gene Summary

• Gene Symbol: SPACA1   Gene   UCSC   Ensembl
• Aliases: SAMP32
• Gene name: sperm acrosome associated 1
• Alternate names: sperm acrosome membrane-associated protein 1, sperm acrosomal membrane-associated protein 32,
• Gene location: 6q15 (88046906: 88066831)     Exons: 8     NC_000006.12
• Gene summary(Entrez): The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targete
• OMIM: 612739

Protein Summary

• Protein general information: Q9HBV2  
  • Name: Sperm acrosome membrane associated protein 1 (Sperm acrosomal membrane associated protein 32)
  • Length: 294  
  • Mass: 32,143
• Sequence:

  MSPRGTGCSAGLLMTVGWLLLAGLQSARGTNVTAAVQDAGLAHEGEGEEETENNDSETAENYAPPETEDVSNRNV
  VKEVEFGMCTVTCGIGVREVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYM
  WKLLRQDQQSIILVNDSAILEVRKESHPLAFECDTLDNNEIVATIKFTVYTSSELQMRRSSLPATDAALIFVLTI
  GVIICVFIIFLLIFIIINWAAVKAFWGAKASTPEVQSEQSSVRYKDSTSLDQLPTEMPGEDDALSEWNE

• Structural information:
  • Interpro: IPR037878  
  • CDD: cd13783
  • STRING: ENSP00000237201
• Other Databases: GeneCards:  SPACA1  Malacards:  SPACA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001675	acrosome assembly	IBA	biological process
GO:0002080	acrosomal membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001675	acrosome assembly	IEA	biological process
GO:0001675	acrosome assembly	IBA	biological process
GO:0002080	acrosomal membrane	IEA	cellular component
GO:0002080	acrosomal membrane	IBA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001675	acrosome assembly	IBA	biological process
GO:0002080	acrosomal membrane	IBA	cellular component

Diseases

Associated diseases	References
Cardiovascular disease	GAD: 17903301
Hyperparathyroidism	GAD: 20424473
Male factor infertility	MIK: 27185107
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Globozoospermia	MIK: 22949614
Male infertility	MIK: 27185107
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
27185107	Male infertility				Male infertility
22949614	Globozoospermia, Mal einfertility, Abnormally shaped sperm heads				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881