Search Result
| Gene id | 81706 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | PPP1R14C Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CPI17-like, KEPI, NY-BR-81 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | protein phosphatase 1 regulatory inhibitor subunit 14C | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | protein phosphatase 1 regulatory subunit 14C, PKC-potentiated PP1 inhibitory protein, kinase C-enhanced PP1 inhibitor, kinase-enhanced PP1 inhibitor, serologically defined breast cancer antigen NY-BR-81, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
6q25.1 (150143043: 150250391) Exons: 5 NC_000006.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The degree of protein phosphorylation is regulated by a balance of protein kinase and phosphatase activities. Protein phosphatase-1 (PP1; see MIM 176875) is a signal-transducing phosphatase that influences neuronal activity, protein synthesis, metabolism, |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 613242 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8TAE6 Name: Protein phosphatase 1 regulatory subunit 14C (Kinase enhanced PP1 inhibitor) (PKC potentiated PP1 inhibitory protein) (Serologically defined breast cancer antigen NY BR 81) Length: 165 Mass: 17843 Tissue specificity: Detected in breast cancer. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MSVATGSSETAGGASGGGARVFFQSPRGGAGGSPGSSSGSGSSREDSAPVATAAAAGQVQQQQQRRHQQGKVTVK YDRKELRKRLVLEEWIVEQLGQLYGCEEEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPTEEFIKELLSR IRGMRKLSPPQKKSV | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: PPP1R14C  Malacards: PPP1R14C | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||