• Gene id: 81603

Gene Summary

• Gene Symbol: TRIM8   Gene   UCSC   Ensembl
• Aliases: GERP, RNF27
• Gene name: tripartite motif containing 8
• Alternate names: E3 ubiquitin-protein ligase TRIM8, RING-type E3 ubiquitin transferase TRIM8, glioblastoma-expressed RING finger protein, probable E3 ubiquitin-protein ligase TRIM8, ring finger protein 27, tripartite motif protein TRIM8,
• Gene location: 10q24.32 (102644478: 102658318)     Exons: 6     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the tripartite motif (TRIM) protein family. Based on similarities to other proteins, the encoded protein is suspected to be an E3 ubiquitin-protein ligase. Regulation of this gene may be altered in some cancers. Mutations res
• OMIM: 606125

Protein Summary

• Protein general information: Q9BZR9  
  • Name: E3 ubiquitin protein ligase TRIM8 (EC 2.3.2.27) (Glioblastoma expressed RING finger protein) (RING finger protein 27) (RING type E3 ubiquitin transferase TRIM8) (Tripartite motif containing protein 8)
  • Length: 551  
  • Mass: 61489
  • Tissue specificity: Widely expressed.
• Sequence:

  MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYNQKPGLEKNLKLTNIV
  EKFNALHVEKPPAALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQTHLQQPSTARGHLLVEADDVRAWSCPQHNA
  YRLYHCEAEQVAVCQYCCYYSGAHQGHSVCDVEIRRNEIRKMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEKV
  NQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGSLQLLFDKTEDVSFMK
  NTKSVKILMDRTQTCTSSSLSPTKIGHLNSKLFLNEVAKKEKQLRKMLEGPFSTPVPFLQSVPLYPCGVSSSGAE
  KRKHSTAFPEASFLETSSGPVGGQYGAAGTASGEGQSGQPLGPCSSTQHLVALPGGAQPVHSSPVFPPSQYPNGS
  AAQQPMLPQYGGRKILVCSVDNCYCSSVANHGGHQPYPRSGHFPWTVPSQEYSHPLPPTPSVPQSLPSLAVRDWL
  DASQQPGHQDFYRVYGQPSTKHYVTS

• Structural information:
  • Interpro: IPR001841  IPR013083  IPR017907  
  • Prosite: PS00518 PS50089
  • STRING: ENSP00000302120
• Other Databases: GeneCards:  TRIM8  Malacards:  TRIM8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0032897	negative regulation of viral transcription	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:1902187	negative regulation of viral release from host cell	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0046597	negative regulation of viral entry into host cell	IEA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:1902187	negative regulation of viral release from host cell	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0016605	PML body	IDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0008270	zinc ion binding	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq