• Gene id: 81537

Gene Summary

• Gene Symbol: SGPP1   Gene   UCSC   Ensembl
• Aliases: SPP-1, SPPase1
• Gene name: sphingosine-1-phosphate phosphatase 1
• Alternate names: sphingosine-1-phosphate phosphatase 1, hSPP1, hSPPase1, sphingosine-1-phosphatase 1, sphingosine-1-phosphate phosphohydrolase 1, spp1,
• Gene location: 14q23.2 (63728107: 63684215)     Exons: 4     NC_000014.9
• Gene summary(Entrez): Sphingosine-1-phosphate (S1P) is a bioactive sphingolipid metabolite that regulates diverse biologic processes. SGPP1 catalyzes the degradation of S1P via salvage and recycling of sphingosine into long-chain ceramides (Mandala et al., 2000 [PubMed 1085935
• OMIM: 611753

Protein Summary

• Protein general information: Q9BX95  
  • Name: Sphingosine 1 phosphate phosphatase 1 (SPPase1) (Spp1) (hSPP1) (hSPPase1) (EC 3.1.3. ) (Sphingosine 1 phosphatase 1) (Sphingosine 1 phosphate phosphohydrolase 1) (SPP 1)
  • Length: 441  
  • Mass: 49108
  • Tissue specificity: Ubiquitous, with the strongest level in placenta and kidney. {ECO
• Sequence:

  MSLRQRLAQLVGRLQDPQKVARFQRLCGVEAPPRRSADRREDEKAEAPLAGDPRLRGRQPGAPGGPQPPGSDRNQ
  CPAKPDGGGAPNGVRNGLAAELGPASPRRAGALRRNSLTGEEGQLARVSNWPLYCLFCFGTELGNELFYILFFPF
  WIWNLDPLVGRRLVVIWVLVMYLGQCTKDIIRWPRPASPPVVKLEVFYNSEYSMPSTHAMSGTAIPISMVLLTYG
  RWQYPLIYGLILIPCWCSLVCLSRIYMGMHSILDIIAGFLYTILILAVFYPFVDLIDNFNQTHKYAPFIIIGLHL
  ALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVTYNMGLVLDPSLDTLPLAGPPITVTLFGKAILRILIGMVF
  VLIIRDVMKKITIPLACKIFNIPCDDIRKARQHMEVELPYRYITYGMVGFSITFFVPYIFFFIGIS

• Structural information:
  • Interpro: IPR036938  IPR000326  
  • STRING: ENSP00000247225
• Other Databases: GeneCards:  SGPP1  Malacards:  SGPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042577	lipid phosphatase activity	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0046839	phospholipid dephosphorylation	IBA	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0006670	sphingosine metabolic process	IBA	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IDA	molecular function
GO:0035621	ER to Golgi ceramide transport	IMP	biological process
GO:0045682	regulation of epidermis development	ISS	biological process
GO:0045616	regulation of keratinocyte differentiation	ISS	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0045616	regulation of keratinocyte differentiation	IEA	biological process
GO:0045682	regulation of epidermis development	IEA	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IEA	biological process
GO:0006668	sphinganine-1-phosphate metabolic process	IEA	biological process
GO:0006670	sphingosine metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042392	sphingosine-1-phosphate phosphatase activity	IEA	molecular function
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04071	Sphingolipid signaling pathway
hsa00600	Sphingolipid metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq