Search Result
| Gene id | 81488 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | POLR2M Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | GCOM1, GRINL1A, Gdown, Gdown1 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | RNA polymerase II subunit M | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | protein GRINL1A, DNA-directed RNA polymerase II subunit M, isoforms 4/5, GRINL1A downstream protein Gdown4, glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A, polymerase (RNA) II (DNA directed) polypeptide M, polymerase (RNA) II subunit M, protein GR, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
15q21.3 (57706520: 57717556) Exons: 4 NC_000015.10 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a subunit of a specific form of RNA polymerase II termed Pol II(G). The encoded protein may act as a negative regulator of transcriptional activation by the Mediator complex. Alternative splicing results in multiple transcript variants. |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 600684 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | P0CAP2 Name: DNA directed RNA polymerase II subunit GRINL1A (DNA directed RNA polymerase II subunit M) (Glutamate receptor like protein 1A) Length: 368 Mass: 41740 Tissue specificity: Detected in adult an fetal brain. Detected in heart, kidney, skeletal muscle, small intestine, lung, prostate and testis. {ECO | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRRKSELF NPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGDEETSEVEYTV NKGPASSNRDRVPPSSEASEHHPRHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGT EKKPHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRRDKQHLDDITAARLLPLHHMP TQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESSGRYREVRDEDDDWSSDEF | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: POLR2M  Malacards: POLR2M | ||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q6EEV4 Name: DNA directed RNA polymerase II subunit GRINL1A, isoforms 4/5 (DNA directed RNA polymerase II subunit M, isoforms 4/5) Length: 148 Mass: 15131 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MATPARAPESPPSADPALVAGPAEEAECPPPRQPQPAQNVLAAPRLRAPSSRGLGAAEFGGAAGNVEAPGETFAQ RVSWGPAESPPGSFSSSSLGAPLPSRTLFPSLEGDFDSVTFASVLRASGRRACCGRAVPLPGQKIHLQIARQR | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information | |||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: POLR2M  Malacards: POLR2M | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||