• Gene id: 81034

Gene Summary

• Gene Symbol: SLC25A32   Gene   UCSC   Ensembl
• Aliases: MFT, MFTC, RREI
• Gene name: solute carrier family 25 member 32
• Alternate names: mitochondrial folate transporter/carrier, solute carrier family 25 (mitochondrial folate carrier), member 32,
• Gene location: 8q22.3 (103415334: 103398637)     Exons: 8     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the P(I/L)W subfamily of mitochondrial carrier family transport proteins. The encoded protein transports folate across the inner mitochondrial membrane. Alternatively spliced transcript variants have been described. [provided
• OMIM: 603173

Protein Summary

• Protein general information: Q9H2D1  
  • Name: Mitochondrial folate transporter/carrier (Solute carrier family 25 member 32)
  • Length: 315  
  • Mass: 35407
  • Tissue specificity: Ubiquitous.
• Sequence:

  MTGQGQSASGSSAWSTVFRHVRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLTTIWKL
  DGLRGLYQGVTPNIWGAGLSWGLYFFFYNAIKSYKTEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLML
  QYDAVVNSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKYNQHINRLPEAQLSTV
  EYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVIDVITKTWRKEGVGGFYKGIAPNLIRVTPACCITFVVY
  ENVSHFLLDLREKRK

• Structural information:
  • Interpro: IPR002030  IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000297578
• Other Databases: GeneCards:  SLC25A32  Malacards:  SLC25A32

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008517	folic acid transmembrane transporter activity	IBA	molecular function
GO:0015230	FAD transmembrane transporter activity	IBA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:1990548	mitochondrial FAD transmembrane transport	IMP	biological process
GO:1904947	folate import into mitochondrion	IMP	biological process
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0006839	mitochondrial transport	IEA	biological process
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0008517	folic acid transmembrane transporter activity	TAS	molecular function
GO:0008517	folic acid transmembrane transporter activity	TAS	molecular function
GO:0046655	folic acid metabolic process	TAS	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:1904947	folate import into mitochondrion	IGI	biological process
GO:0008517	folic acid transmembrane transporter activity	IGI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0015884	folic acid transport	NAS	biological process
GO:0008517	folic acid transmembrane transporter activity	NAS	molecular function
GO:0005743	mitochondrial inner membrane	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray