• Gene id: 80831

Gene Summary

• Gene Symbol: APOL5   Gene   UCSC   Ensembl
• Aliases: APOL-V, APOLV
• Gene name: apolipoprotein L5
• Alternate names: apolipoprotein L5, apolipoprotein L, 5, apolipoprotein L-V,
• Gene location: 22q12.3 (35708423: 35730324)     Exons: 7     NC_000022.11
• Gene summary(Entrez): This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. [provided by RefSeq, Jul 2008]
• OMIM: 610236

Protein Summary

• Protein general information: Q9BWW9  
  • Name: Apolipoprotein L5 (Apolipoprotein L V) (ApoL V)
  • Length: 433  
  • Mass: 47044
  • Tissue specificity: Low level of expression; detected in uterus, testis, skeletal muscle and stomach.
• Sequence:

  MPCGKQGNLQVPGSKVLPGLGEGCKEMWLRKVIYGGEVWGKSPEPEFPSLVNLCQSWKINNLMSTVHSDEAGMLS
  YFLFEELMRCDKDSMPDGNLSEEEKLFLSYFPLHKFELEQNIKELNTLADQVDTTHELLTKTSLVASSSGAVSGV
  MNILGLALAPVTAGGSLMLSATGTGLGAAAAITNIVTNVLENRSNSAARDKASRLGPLTTSHEAFGGINWSEIEA
  AGFCVNKCVKAIQGIKDLHAYQMAKSNSGFMAMVKNFVAKRHIPFWTARGVQRAFEGTTLAMTNGAWVMGAAGAG
  FLLMKDMSSFLQSWKHLEDGARTETAEELRALAKKLEQELDRLTQHHRHLPQKASQTCSSSRGRAVRGSRVVKPE
  GSRSPLPWPVVEHQPRLGPGVALRTPKRTVSAPRMLGHQPAPPAPARKGRQAPGRHRQ

• Structural information:
  • Interpro: IPR008405  
  • STRING: ENSP00000249044
• Other Databases: GeneCards:  APOL5  Malacards:  APOL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0042157	lipoprotein metabolic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008035	high-density lipoprotein particle binding	NAS	molecular function
GO:0006629	lipid metabolic process	NAS	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray