• Gene id: 80775

Gene Summary

• Gene Symbol: TMEM177   Gene   UCSC   Ensembl
• Gene name: transmembrane protein 177
• Alternate names: transmembrane protein 177,
• Gene location: 2q14.2 (119679166: 119723617)     Exons: 19     NC_000002.12
• OMIM: 602724

Protein Summary

• Protein general information: Q53S58  
  • Name: Transmembrane protein 177
  • Length: 311  
  • Mass: 33760
• Sequence:

  MAGPLWRTAAFVQRHRTGLLVGSCAGLFGVPISYHLFPDPVVQWLYQYWPQGQPAPLPPQLQSLFQEVLQDIGVP
  SGHCYKPFTTFTFQPVSAGFPRLPAGAVVGIPASFLGDLVINTNHPVVIHGHTVDWRSPAGARLRASLTLSREAQ
  KFALAREVVYLESSTTAVHALLAPACLAGTWALGVGAKYTLGLHAGPMNLRAAFSLVAAVAGFVAYAFSQDSLTH
  AVESWLDRRTASLSAAYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVPRHLFRIKHLPYTTRRDSVLQ
  MWRGMLNPGRS

• Structural information:
  • Interpro: IPR026620  
  • STRING: ENSP00000402661
• Other Databases: GeneCards:  TMEM177  Malacards:  TMEM177

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031305	integral component of mitochondrial inner membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881