• Gene id: 80758

Gene Summary

• Gene Symbol: PRR7   Gene   UCSC   Ensembl
• Gene name: proline rich 7, synaptic
• Alternate names: proline-rich protein 7, synaptic proline-rich membrane protein,
• Gene location: 5q35.3 (177445994: 177456700)     Exons: 7     NC_000005.10
• OMIM: 612544

Protein Summary

• Protein general information: Q8TB68  
  • Name: Proline rich protein 7 (Synaptic proline rich membrane protein)
  • Length: 274  
  • Mass: 30930
  • Tissue specificity: Strongly expressed in brain tissue including the hippocampus, and moderately expressed in esophagus, trachea, lung, ovary, cervix, prostate, testes, thyroid, thymus, lymph nodes and peripheral blood lymphocytes. {ECO
• Sequence:

  MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPP
  QPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHHALPHPPPTHLSVPPRPWSYPRQAESDMSKP
  PCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPP
  CPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV

• Structural information:
  • STRING: ENSP00000327168
• Other Databases: GeneCards:  PRR7  Malacards:  PRR7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046632	alpha-beta T cell differentiation	IEA	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099092	postsynaptic density, intracellular component	IEA	cellular component
GO:0099527	postsynapse to nucleus signaling pathway	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0010942	positive regulation of cell death	IMP	biological process
GO:0044389	ubiquitin-like protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IMP	cellular component
GO:0031397	negative regulation of protein ubiquitination	IMP	biological process
GO:1990782	protein tyrosine kinase binding	IPI	molecular function
GO:0005886	plasma membrane	IMP	cellular component
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0036041	long-chain fatty acid binding	IMP	molecular function
GO:2001269	positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq