• Gene id: 80741

Gene Summary

• Gene Symbol: LY6G5C   Gene   UCSC   Ensembl
• Aliases: C6orf20, G5C, LY6G5CA, LY6G5CB, NG33
• Gene name: lymphocyte antigen 6 family member G5C
• Alternate names: lymphocyte antigen 6 complex locus protein G5c, lymphocyte antigen 6 complex, locus G5C, lymphocyte antigen-6 G5C,
• Gene location: 6p21.33 (31680372: 31676683)     Exons: 3     NC_000006.12
• Gene summary(Entrez): LY6G5C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
• OMIM: 610589

Protein Summary

• Protein general information: Q5SRR4  
  • Name: Lymphocyte antigen 6 complex locus protein G5c
  • Length: 150  
  • Mass: 16650
  • Tissue specificity: Detected in T-cell lines and fetal and adult lung. {ECO
• Sequence:

  MRFMAGPAGSQSLGPLCFHSSPQALYTVLLIVLVMMSLVFGKFVPVNWEPPQPLPFPKYLRCYRCLLETKELGCL
  LGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCNDPQNRGLYTP

• Structural information:
  • Protein Domains: (60..15-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR026110  
  • STRING: ENSP00000372724
• Other Databases: GeneCards:  LY6G5C  Malacards:  LY6G5C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009897	external side of plasma membrane	IBA	colocalizes with
GO:0005576	extracellular region	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0009897	external side of plasma membrane	IDA	colocalizes with
GO:0042802	identical protein binding	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray