• Gene id: 80345

Gene Summary

• Gene Symbol: ZSCAN16   Gene   UCSC   Ensembl
• Aliases: ZNF392, ZNF435, dJ265C24.3
• Gene name: zinc finger and SCAN domain containing 16
• Alternate names: zinc finger and SCAN domain-containing protein 16, zinc finger protein 392, zinc finger protein 435,
• Gene location: 6p22.1 (28123752: 28130081)     Exons: 4     NC_000006.12
• OMIM: 618544

Protein Summary

• Protein general information: Q9H4T2  
  • Name: Zinc finger and SCAN domain containing protein 16 (Zinc finger protein 392) (Zinc finger protein 435)
  • Length: 348  
  • Mass: 40792
• Sequence:

  MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQDAPGPREALTQLWELCRQWLRPECH
  TKEQILDLLVLEQFLSILPKDLQAWVRAHHPETGEEAVTVLEDLERELDEPGKQVPGNSERRDILMDKLAPLGRP
  YESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGR
  SEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKD
  FSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY

• Structural information:
  • Protein Domains: (41..12-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187"-)
  • Interpro: IPR003309  IPR038269  IPR036236  IPR013087  
  • Prosite: PS50804 PS00028 PS50157
  • CDD: cd07936
  • PDB: 2COT
  • PDBsum: 2COT
  • STRING: ENSP00000366527
• Other Databases: GeneCards:  ZSCAN16  Malacards:  ZSCAN16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881