Search Result
| Gene id | 80341 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | BPIFB2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | BPIL1, C20orf184, LPLUNC2, RYSR, dJ726C3.2 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | BPI fold containing family B member 2 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | BPI fold-containing family B member 2, BPI-like 1, bactericidal/permeability-increasing protein-like 1, long palate, lung and nasal epithelium carcinoma-associated protein 2, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
20q11.21 (33007703: 33023702) Exons: 16 NC_000020.11 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) gene family. It is highly expressed in hypertrophic tonsils. This gene and three other members of the LT/LBP gene family form a cluster on the long arm of chromos |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 609692 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8N4F0 Name: BPI fold containing family B member 2 (Bactericidal/permeability increasing protein like 1) (BPI like 1) (Long palate, lung and nasal epithelium carcinoma associated protein 2) (RYSR) Length: 458 Mass: 49172 Tissue specificity: Highly expressed in tonsils, especially in hypertrophic tonsils. Detected at very low levels in fetal liver. {ECO | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVH VPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGS NSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAV LFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRL IPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDVVVNLRLQLSVSKVKL QGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNALLAMGIALPGVVNLHYVAPEIFVYEGYVVI SSGLFYQS | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: BPIFB2  Malacards: BPIFB2 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||