• Gene id: 80336

Gene Summary

• Gene Symbol: PABPC1L   Gene   UCSC   Ensembl
• Aliases: C20orf119, EPAB, PABPC1L1, dJ1069P2.3
• Gene name: poly(A) binding protein cytoplasmic 1 like
• Alternate names: polyadenylate-binding protein 1-like, embryonic poly(A) binding protein,
• Gene location: 20q13.12 (44910059: 44959159)     Exons: 19     NC_000020.11
• OMIM: 0

Protein Summary

• Protein general information: Q4VXU2  
  • Name: Polyadenylate binding protein 1 like
  • Length: 614  
  • Mass: 68,392
• Sequence:

  MNASGSGYPLASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDVATRRSLGYAYINFQQPADAERALDTMNFE
  MLKGQPIRIMWSQRDPGLRKSGVGNIFIKNLEDSIDNKALYDTFSTFGNILSCKVACDEHGSRGFGFVHFETHEA
  AQQAINTMNGMLLNDRKVFVGHFKSRREREAELGARALEFTNIYVKNLPVDVDEQGLQDLFSQFGKMLSVKVMRD
  NSGHSRCFGFVNFEKHEEAQKAVVHMNGKEVSGRLLYAGRAQKRVERQNELKRRFEQMKQDRLRRYQGVNLYVKN
  LDDSIDDDKLRKEFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNGRIVGTKPLYVALAQRKEERK
  AILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQPAPRWTSQPPRPSCASMVRP
  PVVPRRPPAHISSVRQASTQVPRTVPHTQRVANIGTQTTGPSGVGCCTPGRPLLPCKCSSAAHSTYRVQEPAVHI
  PGQEPLTASMLAAAPLHEQKQMIGERLYPLIHDVHTQLAGKITGMLLEIDNSELLLMLESPESLHAKIDEAVAVL
  QAHQAMEQPKAYMH

• Structural information:
  • Protein Domains: RRM (11-89)
    RRM (99-175)
    RRM (191-268)
    RRM (294-370)
    (-)
  • Interpro: IPR012677  IPR036053  IPR006515  IPR002004  IPR035979   IPR000504  IPR003954  
  • Prosite: PS51309 PS50102
  • STRING: ENSP00000217073
• Other Databases: GeneCards:  PABPC1L  Malacards:  PABPC1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000166	nucleotide binding	IEA	molecular function
GO:0001556	oocyte maturation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006378	mRNA polyadenylation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0001556	oocyte maturation	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006378	mRNA polyadenylation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 26843391
Non obstructive azoospermia	MIK: 26843391
Male infertility	MIK: 26843391
Non-obstructive azoospermia	MIK: 26843391
NOA including hypospermatogenesis	MIK: 26843391
RS arrest	MIK: 26843391
SC arrest	MIK: 26843391
Sertoli cell-only syndrome (SCOS)	MIK: 26843391
Male infertility	MIK: 26843391

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26843391	Male infertility, non-obstructive azoospermia				Male infertility	EPAB PABPC1 and PABPC3
26843391	NOA including hypospermatogenesis (hyposperm), RS arrest, SC arrest, and Sertoli cell-only syndrome (SCO), Male infertility				Male infertility