• Gene id: 80328

Gene Summary

• Gene Symbol: ULBP2   Gene   UCSC   Ensembl
• Aliases: ALCAN-alpha, N2DL2, NKG2DL2, RAET1H, RAET1L
• Gene name: UL16 binding protein 2
• Alternate names: UL16-binding protein 2, NKG2D ligand 2, retinoic acid early transcript 1H, retinoic acid early transcript 1L,
• Gene location: 6q25.1 (149941946: 149949234)     Exons: 5     NC_000006.12
• Gene summary(Entrez): This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activa
• OMIM: 601802

Protein Summary

• Protein general information: Q9BZM5  
  • Name: UL16 binding protein 2 (ALCAN alpha) (NKG2D ligand 2) (N2DL 2) (NKG2DL2) (Retinoic acid early transcript 1H)
  • Length: 246  
  • Mass: 27368
  • Tissue specificity: Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues. {ECO
• Sequence:

  MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVS
  PLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLL
  FDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRAT
  ATTLILCCLLIILPCFILPGI

• Structural information:
  • Interpro: IPR011161  IPR037055  IPR011162  
  • STRING: ENSP00000356320
• Other Databases: GeneCards:  ULBP2  Malacards:  ULBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046703	natural killer cell lectin-like receptor binding	IDA	molecular function
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:0042267	natural killer cell mediated cytotoxicity	IDA	biological process
GO:0030101	natural killer cell activation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04650	Natural killer cell mediated cytotoxicity

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881