• Gene id: 80315

Gene Summary

• Gene Symbol: CPEB4   Gene   UCSC   Ensembl
• Aliases: CPE-BP4, hCPEB-4
• Gene name: cytoplasmic polyadenylation element binding protein 4
• Alternate names: cytoplasmic polyadenylation element-binding protein 4, CPE-binding protein 4,
• Gene location: 5q35.2 (173888327: 173961979)     Exons: 12     NC_000005.10
• OMIM: 610607

Protein Summary

• Protein general information: Q17RY0  
  • Name: Cytoplasmic polyadenylation element binding protein 4 (CPE BP4) (CPE binding protein 4) (hCPEB 4)
  • Length: 729  
  • Mass: 80152
  • Tissue specificity: Expressed in pancreas in islets and ductal cells (at protein level) (PubMed
• Sequence:

  MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAWLFPAPATHNIQDEIL
  GSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQGDNSSENGNGKEKIRIESPVLTGFDYQEATG
  LGTSTQPLTSSASSLTGFSNWSAAIAPSSSTIINEDASFFHQGGVPAASANNGALLFQNFPHHVSPGFGGSFSPQ
  IGPLSQHHPHHPHFQHHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNKPPSPWSSYQSPSPTPSSSWS
  PGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYARPSSAFAPKSWMEDSLNRADNIFPFP
  DRPRTFDMHSLESSLIDIMRAENDTIKGRLNYSYPGSDSSLLINARTYGRRRGQSSLFPMEDGFLDDGRGDQPLH
  SGLGSPHCFSHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDE
  SSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIM
  DRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARC
  GGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRWN

• Structural information:
  • Protein Domains: (472..56-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (580..66-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR032296  IPR038446  IPR034819  IPR012677  IPR035979   IPR000504  
  • Prosite: PS50102
  • PDB: 2MKI 2MKJ 5DIF
  • PDBsum: 2MKI 2MKJ 5DIF
  • STRING: ENSP00000265085
• Other Databases: GeneCards:  CPEB4  Malacards:  CPEB4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043022	ribosome binding	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0008135	translation factor activity, RNA binding	IBA	molecular function
GO:2000766	negative regulation of cytoplasmic translation	IBA	biological process
GO:1990124	messenger ribonucleoprotein complex	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0000900	translation repressor activity, mRNA regulatory element binding	IBA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071230	cellular response to amino acid stimulus	ISS	biological process
GO:0071230	cellular response to amino acid stimulus	ISS	biological process
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0036294	cellular response to decreased oxygen levels	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0002931	response to ischemia	ISS	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0045182	translation regulator activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04114	Oocyte meiosis
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
Portal hypertension	PMID:26627607
Primary biliary cirrhosis	PMID:26627607
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881