• Gene id: 80255

Gene Summary

• Gene Symbol: SLC35F5   Gene   UCSC   Ensembl
• Gene name: solute carrier family 35 member F5
• Alternate names: solute carrier family 35 member F5, HCV NS5A-transactivated protein 3, hepatitis C virus NS5A-transactivated protein 3,
• Gene location: 2q14.1 (113756641: 113702676)     Exons: 20     NC_000002.12
• OMIM: 0

Protein Summary

• Protein general information: Q8WV83  
  • Name: Solute carrier family 35 member F5 (Hepatitis C virus NS5A transactivated protein 3) (HCV NS5A transactivated protein 3)
  • Length: 523  
  • Mass: 58887
  • Tissue specificity: Expressed in colorectal cancer cells. {ECO
• Sequence:

  MVPPRRHRGAGRPGVLSSSPPFRLRSAKFSGIALEDLRRALKTRLQMVCVFVMNRMNSQNSGFTQRRRMALGIVI
  LLLVDVIWVASSELTSYVFTQYNKPFFSTFAKTSMFVLYLLGFIIWKPWRQQCTRGLRGKHAAFFADAEGYFAAC
  TTDTTMNSSLSEPLYVPVKFHDLPSEKPESTNIDTEKTPKKSRVRFSNIMEIRQLPSSHALEAKLSRMSYPVKEQ
  ESILKTVGKLTATQVAKISFFFCFVWFLANLSYQEALSDTQVAIVNILSSTSGLFTLILAAVFPSNSGDRFTLSK
  LLAVILSIGGVVLVNLAGSEKPAGRDTVGSIWSLAGAMLYAVYIVMIKRKVDREDKLDIPMFFGFVGLFNLLLLW
  PGFFLLHYTGFEDFEFPNKVVLMCIIINGLIGTVLSEFLWLWGCFLTSSLIGTLALSLTIPLSIIADMCMQKVQF
  SWLFFAGAIPVFFSFFIVTLLCHYNNWDPVMVGIRRIFAFICRKHRIQRVPEDSEQCESLISMHSVSQEDGAS

• Structural information:
  • Protein Domains: (252..31-)
    (/note="EamA"-)
  • Interpro: IPR000620  
  • STRING: ENSP00000245680
• Other Databases: GeneCards:  SLC35F5  Malacards:  SLC35F5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)