• Gene id: 80231

Gene Summary

• Gene Symbol: CXorf21   Gene   UCSC   Ensembl
• Gene name: chromosome X open reading frame 21
• Alternate names: protein CXorf21, 5430427O19Rik, uncharacterized protein CXorf21,
• Gene location: Xp21.2 (30577765: 30558808)     Exons: 3     NC_000023.11

Protein Summary

• Protein general information: Q9HAI6  
  • Name: Protein CXorf21
  • Length: 301  
  • Mass: 33894
  • Tissue specificity: Highly expressed in immune cell types such as B-cells, neutrophils, dendritic cells and monocytes, the expression levels are two-three-fold higher in female cells compared to male cells (at protein level) (PubMed
• Sequence:

  MLSEGYLSGLEYWNDIHWSCASYNEQVAGEKEEETNSVATLSYSSVDETQVRSLYVSCKSSGKFISSVHSRESQH
  SRSQRVTVLQTNPNPVFESPNLAAVEICRDASRETYLVPSSCKSICKNYNDLQIAGGQVMAINSVTTDFPSESSF
  EYGPLLKSSEIPLPMEDSISTQPSDFPQKPIQRYSSYWRITSIKEKSSLQMQNPISNAVLNEYLEQKVVELYKQY
  IMDTVFHDSSPTQILASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMSTEITEISTPSLHISQYSNVN
  P

• Structural information:
  • Interpro: IPR027869  
  • STRING: ENSP00000368245
• Other Databases: GeneCards:  CXorf21  Malacards:  CXorf21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035751	regulation of lysosomal lumen pH	IBA	biological process
GO:0005623	obsolete cell	IDA	cellular component
GO:0035751	regulation of lysosomal lumen pH	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R