• Gene id: 80213

Gene Summary

• Gene Symbol: TM2D3   Gene   UCSC   Ensembl
• Aliases: BLP2
• Gene name: TM2 domain containing 3
• Alternate names: TM2 domain-containing protein 3, BBP-like protein 2, almondex homolog, beta-amyloid-binding protein-like protein 2,
• Gene location: 15q26.3 (101652390: 101632976)     Exons: 7     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, u
• OMIM: 610014

Protein Summary

• Protein general information: Q9BRN9  
  • Name: TM2 domain containing protein 3 (Beta amyloid binding protein like protein 2) (BBP like protein 2)
  • Length: 247  
  • Mass: 27118
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAGGVLPLRGLRALCRVLLFLSQFCILSGGEQSQALAQSIKDPGPTRTFTVVPRAAESTEIPPYVMKCPSNGLCS
  RLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSCP
  RQRYPANCTVRDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIW
  TLIDVLLIGVGYVGPADGSLYI

• Structural information:
  • Interpro: IPR007829  
  • STRING: ENSP00000330433
• Other Databases: GeneCards:  TM2D3  Malacards:  TM2D3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881