• Gene id: 80196

Gene Summary

• Gene Symbol: RNF34   Gene   UCSC   Ensembl
• Aliases: CARP-1, CARP1, RFI, RIF, RIFF, hRFI
• Gene name: ring finger protein 34
• Alternate names: E3 ubiquitin-protein ligase RNF34, FYVE-RING finger protein MOMO, RING finger protein RIFF, RING-type E3 ubiquitin transferase RNF34, caspase regulator CARP1, caspases-8 and -10-associated RING finger protein 1, human RING finger homologous to inhibitor of apop,
• Gene location: 12q24.31 (121400082: 121424351)     Exons: 9     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Ove
• OMIM: 608299

Protein Summary

• Protein general information: Q969K3  
  • Name: E3 ubiquitin protein ligase RNF34 (EC 2.3.2.27) (Caspase regulator CARP1) (Caspases 8 and 10 associated RING finger protein 1) (CARP 1) (FYVE RING finger protein Momo) (Human RING finger homologous to inhibitor of apoptosis protein) (hRFI) (RING finger p
  • Length: 372  
  • Mass: 41641
  • Tissue specificity: Ubiquitous. Detected in heart, brain, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, colon and leukocytes. {ECO
• Sequence:

  MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFSVFRKK
  HVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREKEDLVDLVLCH
  HGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSANTEDDD
  DDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLY
  KENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS

• Structural information:
  • Protein Domains: (115..13-)
    (/note="SAP-1)
    (264..27-)
    (/note="SAP-2")
  • Interpro: IPR036361  IPR011011  IPR001841  IPR013083  
  • Prosite: PS50089
  • STRING: ENSP00000376258
• Other Databases: GeneCards:  RNF34  Malacards:  RNF34

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0070936	protein K48-linked ubiquitination	IBA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:2001271	negative regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:1901981	phosphatidylinositol phosphate binding	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0002039	p53 binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0002039	p53 binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0070936	protein K48-linked ubiquitination	IMP	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:2000374	regulation of oxygen metabolic process	ISS	biological process
GO:0035872	nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	IMP	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IMP	biological process
GO:1901797	negative regulation of signal transduction by p53 class mediator	IMP	biological process
GO:2001271	negative regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis	IMP	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:2000374	regulation of oxygen metabolic process	IEA	biological process
GO:0070417	cellular response to cold	IEA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0012505	endomembrane system	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881