• Gene id: 80178

Gene Summary

• Gene Symbol: TEDC2   Gene   UCSC   Ensembl
• Aliases: C16orf59
• Gene name: tubulin epsilon and delta complex 2
• Alternate names: tubulin epsilon and delta complex protein 2, uncharacterized protein C16orf59,
• Gene location: 16p13.3 (2460108: 2464962)     Exons: 10     NC_000016.10
• OMIM: 604644

Protein Summary

• Protein general information: Q7L2K0  
  • Name: Tubulin epsilon and delta complex protein 2
  • Length: 433  
  • Mass: 46402
• Sequence:

  MLPAGCSRRLVAELQGALDACAQRQLQLEQSLRVCRRLLHAWEPTGTRALKPPPGPETNGEDPLPACTPSPQDLK
  ELEFLTQALEKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTKGLRQTTVPAK
  GHPERRLLSVGDGTRVGMGARTPRPGAGLRDQQMAPSAAPQAPEAFTLKEKGHLLRLPAAFRKAASQNSSLWAQL
  SSTQTSDSTDAAAAKTQFLQNMQTASGGPQPRLSAVEVEAEAGRLRKACSLLRLRMREELSAAPMDWMQEYRCLL
  TLEGLQAMVGQCLHRLQELRAAVAEQPPRPCPVGRPPGASPSCGGRAEPAWSPQLLVYSSTQELQTLAALKLRVA
  VLDQQIHLEKVLMAELLPLVSAAQPQGPPWLALCRAVHSLLCEGGARVLTILRDEPAV

• Structural information:
  • Interpro: IPR031518  
  • STRING: ENSP00000355022
• Other Databases: GeneCards:  TEDC2  Malacards:  TEDC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045880	positive regulation of smoothened signaling pathway	ISS	biological process
GO:0005929	cilium	ISS	cellular component
GO:0005814	centriole	ISS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005814	centriole	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray