• Gene id: 80148

Gene Summary

• Gene Symbol: SLC66A2   Gene   UCSC   Ensembl
• Aliases: PQLC1
• Gene name: solute carrier family 66 member 2
• Alternate names: solute carrier family 66 member 2, PQ loop repeat containing 1, PQ-loop repeat-containing protein 1,
• Gene location: 18q23 (79951664: 79902419)     Exons: 14     NC_000018.10

Protein Summary

• Protein general information: Q8N2U9  
  • Name: Solute carrier family 66 member 2 (PQ loop repeat containing protein 1)
  • Length: 271  
  • Mass: 30478
• Sequence:

  MEAEGLDWLLVPLHQLVSWGAAAAMVFGGVVPYVPQYRDIRRTQNADGFSTYVCLVLLVANILRILFWFGRRFES
  PLLWQSAIMILTMLLMLKLCTEVRVANELNARRRSFTAADSKDEEVKVAPRRSFLDFDPHHFWQWSSFSDYVQCV
  LAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKG
  APLQFSVCGLLQVLVDLAILGQAYAFARHPQKPAPHAVHPTGTKAL

• Structural information:
  • Protein Domains: (14..8-)
    (/note="PQ-loop-1)
    (178..23-)
    (/note="PQ-loop-2")
  • Interpro: IPR006603  
  • STRING: ENSP00000380880
• Other Databases: GeneCards:  SLC66A2  Malacards:  SLC66A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IEA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0045332	phospholipid translocation	IBA	biological process
GO:0005768	endosome	IBA	cellular component
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray