• Gene id: 80139

Gene Summary

• Gene Symbol: ZNF703   Gene   UCSC   Ensembl
• Aliases: NLZ1, ZEPPO1, ZNF503L, ZPO1
• Gene name: zinc finger protein 703
• Alternate names: zinc finger protein 703, zinc finger elbow-related proline domain protein 1,
• Gene location: 8p11.23 (37695781: 37700018)     Exons: 2     NC_000008.11
• OMIM: 600345

Protein Summary

• Protein general information: Q9H7S9  
  • Name: Zinc finger protein 703 (Zinc finger elbow related proline domain protein 1)
  • Length: 590  
  • Mass: 58222
  • Tissue specificity: Expressed in mammary epithelium. {ECO
• Sequence:

  MSDSPAGSNPRTPESSGSGSGGGGKRPAVPAAVSLLPPADPLRQANRLPIRVLKMLSAHTGHLLHPEYLQPLSST
  PVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGLGAEKDPGRSAPGAASAAAALKQLGDSPAED
  KSSFKPYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGS
  PHHSDCKNGGGVGGGELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYK
  PGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSSSPLTGASPPSFLQGL
  CRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPGHPLQPAALSSSAAQAALPGHPLYTYGFMLQ
  NEPLPHSCNWVAASGPCDKRFATSEELLSHLRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAA
  PGSPGSLSLRNPHTLGLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ

• Structural information:
  • Interpro: IPR022129  IPR013087  
  • Prosite: PS50157
  • STRING: ENSP00000332325
• Other Databases: GeneCards:  ZNF703  Malacards:  ZNF703

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0070491	repressing transcription factor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0051726	regulation of cell cycle	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0033601	positive regulation of mammary gland epithelial cell proliferation	IDA	biological process
GO:0017015	regulation of transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0016363	nuclear matrix	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0060644	mammary gland epithelial cell differentiation	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0034333	adherens junction assembly	ISS	biological process
GO:0034111	negative regulation of homotypic cell-cell adhesion	ISS	biological process
GO:0030335	positive regulation of cell migration	ISS	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070491	repressing transcription factor binding	IEA	molecular function
GO:0060828	regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0034333	adherens junction assembly	IEA	biological process
GO:0034111	negative regulation of homotypic cell-cell adhesion	IEA	biological process
GO:0033601	positive regulation of mammary gland epithelial cell proliferation	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0017015	regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881