• Gene id: 80128

Gene Summary

• Gene Symbol: TRIM46   Gene   UCSC   Ensembl
• Aliases: GENEY, TRIFIC
• Gene name: tripartite motif containing 46
• Alternate names: tripartite motif-containing protein 46, gene Y protein, tripartite, fibronectin type-III and C-terminal SPRY motif protein,
• Gene location: 1q22 (155173380: 155184970)     Exons: 16     NC_000001.11

Protein Summary

• Protein general information: Q7Z4K8  
  • Name: Tripartite motif containing protein 46 (Gene Y protein) (GeneY) (Tripartite, fibronectin type III and C terminal SPRY motif protein)
  • Length: 759  
  • Mass: 83424
• Sequence:

  MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREVLGQQGYIGHGGDPSS
  EPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGALHPQVIMFPCPACQGDVELGERGLAGLFRN
  LTLERVVERYRQSVSVGGAILCQLCKPPPLEATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGL
  MCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVR
  HTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLARLSAQIQEHRSLLDGSGLVGYAQEVLKETDQ
  PCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKLLTELNFLRVPEAPVIDTQRTFAYDQIFLCW
  RLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHT
  PPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYWACAVDP
  ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGKILLGSGASSNAGLTG
  RDGPTAGCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDCSGPVCPAFCFIGGGAVQLQEPVGTKPERKV
  TIGGFAKLD

• Structural information:
  • Protein Domains: (370..42-)
    (/note="COS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00586-)
    (429..52-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (526..74-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR001870  IPR013320  IPR017903  IPR003961  IPR036116   IPR013783  IPR035731  IPR027370  IPR000315  IPR001841  IPR017907  
  • Prosite: PS50188 PS51262 PS50853 PS50119 PS00518
  • CDD: cd00021 cd00063 cd12895
  • STRING: ENSP00000334657
• Other Databases: GeneCards:  TRIM46  Malacards:  TRIM46

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044304	main axon	ISS	cellular component
GO:0044304	main axon	ISS	cellular component
GO:1903827	regulation of cellular protein localization	ISS	biological process
GO:1903827	regulation of cellular protein localization	ISS	biological process
GO:1901953	positive regulation of anterograde dense core granule transport	ISS	biological process
GO:0030517	negative regulation of axon extension	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001764	neuron migration	IEA	biological process
GO:0044304	main axon	IEA	cellular component
GO:0099612	protein localization to axon	IEA	biological process
GO:1903827	regulation of cellular protein localization	IEA	biological process
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0043194	axon initial segment	IEA	cellular component
GO:0048490	anterograde synaptic vesicle transport	IEA	biological process
GO:1990769	proximal neuron projection	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R