• Gene id: 80097

Gene Summary

• Gene Symbol: MZT2B   Gene   UCSC   Ensembl
• Aliases: FAM128B, MOZART2B
• Gene name: mitotic spindle organizing protein 2B
• Alternate names: mitotic-spindle organizing protein 2B, family with sequence similarity 128, member B, mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B,
• Gene location: 2q21.1 (130182261: 130190726)     Exons: 4     NC_000002.12
• OMIM: 613450

Protein Summary

• Protein general information: Q6NZ67  
  • Name: Mitotic spindle organizing protein 2B (Mitotic spindle organizing protein associated with a ring of gamma tubulin 2B)
  • Length: 158  
  • Mass: 16226
• Sequence:

  MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQM
  LKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPG
  KSPTRGST

• Structural information:
  • Interpro: IPR024332  
  • STRING: ENSP00000281871
• Other Databases: GeneCards:  MZT2B  Malacards:  MZT2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008274	gamma-tubulin ring complex	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0005819	spindle	IBA	cellular component
GO:0008274	gamma-tubulin ring complex	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881