• Gene id: 80045

Gene Summary

• Gene Symbol: GPR157   Gene   UCSC   Ensembl
• Gene name: G protein-coupled receptor 157
• Alternate names: G-protein coupled receptor 157, probable G-protein coupled receptor 157,
• Gene location: 1p36.22 (9129123: 9100304)     Exons: 4     NC_000001.11
• OMIM: 0

Protein Summary

• Protein general information: Q5UAW9  
  • Name: G protein coupled receptor 157
  • Length: 335  
  • Mass: 36623
• Sequence:

  MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGP
  SWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDAS
  DVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADK
  KLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSS
  QPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST

• Structural information:
  • Interpro: IPR022343  IPR017981  IPR000832  IPR017452  
  • Prosite: PS50261
  • STRING: ENSP00000366628
• Other Databases: GeneCards:  GPR157  Malacards:  GPR157

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060019	radial glial cell differentiation	ISS	biological process
GO:0060170	ciliary membrane	ISS	cellular component
GO:0004930	G protein-coupled receptor activity	ISS	molecular function
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	ISS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	ISS	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0060019	radial glial cell differentiation	IEA	biological process
GO:0048512	circadian behavior	IEA	biological process
GO:0060170	ciliary membrane	IEA	cellular component
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0060170	ciliary membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R