• Gene id: 79968

Gene Summary

• Gene Symbol: WDR76   Gene   UCSC   Ensembl
• Aliases: CDW14
• Gene name: WD repeat domain 76
• Alternate names: WD repeat-containing protein 76,
• Gene location: 15q15.3 (43826976: 43868418)     Exons: 13     NC_000015.10

Protein Summary

• Protein general information: Q9H967  
  • Name: WD repeat containing protein 76
  • Length: 626  
  • Mass: 69769
• Sequence:

  MSRSGAAAEKADSRQRPQMKVNEYKENQNIAYVSLRPAQTTVLIKTAKVYLAPFSLSNYQLDQLMCPKSLSEKNS
  NNEVACKKTKIKKTCRRIIPPKMKNTSSKAESTLQNSSSAVHTESNKLQPKRTADAMNLSVDVESSQDGDSDEDT
  TPSLDFSGLSPYERKRLKNISENADFFASLQLSESAARLREMIEKRQPPKSKRKKPKRENGIGCRRSMRLLKVDP
  SGVSLPAAPTPPTLVADETPLLPPGPLEMTSENQEDNNERFKGFLHTWAGMSKPSSKNTEKGLSSIKSYKANLNG
  MVISEDTVYKVTTGPIFSMALHPSETRTLVAVGAKFGQVGLCDLTQQPKEDGVYVFHPHSQPVSCLYFSPANPAH
  ILSLSYDGTLRCGDFSRAIFEEVYRNERSSFSSFDFLAEDASTLIVGHWDGNMSLVDRRTPGTSYEKLTSSSMGK
  IRTVHVHPVHRQYFITAGLRDTHIYDARRLNSRRSQPLISLTEHTKSIASAYFSPLTGNRVVTTCADCNLRIFDS
  SCISSKIPLLTTIRHNTFTGRWLTRFQAMWDPKQEDCVIVGSMAHPRRVEIFHETGKRVHSFGGEYLVSVCSINA
  MHPTRYILAGGNSSGKIHVFMNEKSC

• Structural information:
  • Interpro: IPR033052  IPR015943  IPR001680  IPR036322  
  • STRING: ENSP00000263795
• Other Databases: GeneCards:  WDR76  Malacards:  WDR76

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000001	regulation of DNA damage checkpoint	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090734	site of DNA damage	IMP	cellular component
GO:0000792	heterochromatin	IMP	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq