• Gene id: 79966

Gene Summary

• Gene Symbol: SCD5   Gene   UCSC   Ensembl
• Aliases: ACOD4, FADS4, HSCD5, SCD2, SCD4
• Gene name: stearoyl-CoA desaturase 5
• Alternate names: stearoyl-CoA desaturase 5, acyl-CoA-desaturase 4, stearoyl-CoA 9-desaturase, stearoyl-CoA desaturase 2, stearoyl-CoA desaturase 4,
• Gene location: 4q21.22 (82798856: 82629538)     Exons: 28     NC_000004.12
• Gene summary(Entrez): Stearoyl-CoA desaturase (SCD; EC 1.14.99.5) is an integral membrane protein of the endoplasmic reticulum that catalyzes the formation of monounsaturated fatty acids from saturated fatty acids. SCD may be a key regulator of energy metabolism with a role in
• OMIM: 608370

Protein Summary

• Protein general information: Q86SK9  
  • Name: Stearoyl CoA desaturase 5 (EC 1.14.19.1) (Acyl CoA desaturase 4) (HSCD5) (Stearoyl CoA 9 desaturase) (Stearoyl CoA desaturase 2)
  • Length: 330  
  • Mass: 37610
  • Tissue specificity: Detected in fetal brain, and at lower levels in fetal kidney. Detected in adult brain and pancreas, and at lower levels in kidney and lung. {ECO
• Sequence:

  MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKAKPLTL
  LWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAFQNDIFEWSRDHRAHHKYSETDADPHNARRG
  FFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRIQRKYYKISVVLMCFVVPTLVPWYIWGESLWNSYFLASI
  LRYTISLNISWLVNSAAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDF
  MCWLGLATDRKRATKPMIEARKARTGDSSA

• Structural information:
  • Interpro: IPR015876  IPR005804  IPR001522  
  • Prosite: PS00476
  • CDD: cd03505
  • STRING: ENSP00000316329
• Other Databases: GeneCards:  SCD5  Malacards:  SCD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004768	stearoyl-CoA 9-desaturase activity	IBA	molecular function
GO:0005506	iron ion binding	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0006636	unsaturated fatty acid biosynthetic process	IBA	biological process
GO:0006636	unsaturated fatty acid biosynthetic process	IDA	biological process
GO:0004768	stearoyl-CoA 9-desaturase activity	IDA	molecular function
GO:0006636	unsaturated fatty acid biosynthetic process	IDA	biological process
GO:0004768	stearoyl-CoA 9-desaturase activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016717	oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004768	stearoyl-CoA 9-desaturase activity	IEA	molecular function
GO:0046949	fatty-acyl-CoA biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04152	AMPK signaling pathway
hsa03320	PPAR signaling pathway
hsa01212	Fatty acid metabolism
hsa01040	Biosynthesis of unsaturated fatty acids

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray