• Gene id: 7993

Gene Summary

• Gene Symbol: UBXN8   Gene   UCSC   Ensembl
• Aliases: D8S2298E, REP8, UBXD6
• Gene name: UBX domain protein 8
• Alternate names: UBX domain-containing protein 8, Reproduction/chromosome 8, UBX domain-containing protein 6, rep-8 protein, reproduction 8 protein,
• Gene location: 8p12 (30729130: 30767005)     Exons: 11     NC_000008.11
• Gene summary(Entrez): p97 or VCP (valosin-containing protein) is a versatile ATPase complex, and many cofactors are required for the p97 functional diversity. This gene encodes one of the p97 cofactors. This cofactor is a transmembrane protein and localized in the endoplasmic
• OMIM: 605000

Protein Summary

• Protein general information: O00124  
  • Name: UBX domain containing protein 8 (Reproduction 8 protein) (Rep 8 protein) (UBX domain containing protein 6)
  • Length: 270  
  • Mass: 30541
  • Tissue specificity: Expressed abundantly in ovary and testis, and weakly in all other tissues tested.
• Sequence:

  MASRGVVGIFFLSAVPLVCLELRRGIPDIGIKDFLLLCGRILLLLALLTLIISVTTSWLNSFKSPQVYLKEEEEK
  NEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHKLGGDEGTSQTSFETSNR
  EAAKSQNLPKPLTEFPSPAEQPTCKEIPDLPEEPSQTAEEVVTVALRCPSGNVLRRRFLKSYSSQVLFDWMTRIG
  YHISLYSLSTSFPRRPLAVEGGQSLEDIGITVDTVLILEEKEQTN

• Structural information:
  • Protein Domains: (187..26-)
    (/note="UBX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00215"-)
  • Interpro: IPR029071  IPR001012  IPR017247  
  • Prosite: PS50033
  • STRING: ENSP00000479216
• Other Databases: GeneCards:  UBXN8  Malacards:  UBXN8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030433	ubiquitin-dependent ERAD pathway	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007338	single fertilization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881