|
Gene id |
79921 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
TCEAL4 Gene UCSC Ensembl |
|
Aliases |
NPD017, WEX7 |
|
Gene name |
transcription elongation factor A like 4 |
|
Alternate names |
transcription elongation factor A protein-like 4, TCEA-like protein 4, epididymis secretory sperm binding protein, transcription elongation factor A (SII)-like 4, transcription elongation factor S-II protein-like 4, |
|
Gene location |
Xq22.2 (103576230: 103587735) Exons: 7 NC_000023.11
|
|
Gene summary(Entrez) |
This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. This family is comprised of nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located
|
Protein Summary
|
| Protein general information
| Q96EI5
Name: Transcription elongation factor A protein like 4 (TCEA like protein 4) (Transcription elongation factor S II protein like 4)
Length: 215 Mass: 24647
|
| Sequence |
MEKLYSENEGMASNQGKMENEEQPQDERKPEVTCTLEDKKLENEGKTENKGKTGDEEMLKDKGKPESEGEAKEGK SEREGESEMEGGSEREGKPEIEGKPESEGEPGSETRAAGKRPAEDDVPRKAKRKTNKGLAHYLKEYKEAIHDMNF SNEDMIREFDNMAKVQDEKRKSKQKLGAFLWMQRNLQDPFYPRGPREFRGGCRAPRRDIEDIPYV
|
| Structural information |
|
| Other Databases |
GeneCards: TCEAL4  Malacards: TCEAL4 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0005634 |
nucleus
|
IBA |
cellular component |
GO:0050699 |
WW domain binding
|
IBA |
molecular function |
GO:0005634 |
nucleus
|
IEA |
cellular component |
GO:0005634 |
nucleus
|
IEA |
cellular component |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 31037746 |
Spermatoge nic defect s
|
|
|
16 (1 control, 15 cases)
|
Male infertility |
GSE6023 analyzed using GEO2R
|
Show abstract |
|