• Gene id: 79908

Gene Summary

• Gene Symbol: BTNL8   Gene   UCSC   Ensembl
• Aliases: BTN9.2
• Gene name: butyrophilin like 8
• Alternate names: butyrophilin-like protein 8, B7-H5 costimulatory molecule,
• Gene location: 5q35.3 (180899076: 180952165)     Exons: 12     NC_000005.10

Protein Summary

• Protein general information: Q6UX41  
  • Name: Butyrophilin like protein 8
  • Length: 500  
  • Mass: 56748
  • Tissue specificity: Expressed in neutrophils. Isoforms 1 and 5 are expressed at high levels in the colon, lung,testis, lymph nodes and thyroid tissue. Isoform 5, but not isoform 1, is detected in spleen. {ECO
• Sequence:

  MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPF
  MQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLISITGYVDRDI
  QLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRHAHLSREVESRVQIGD
  TFFEPISWHLATKVLGILCCGLFFGIVGLKIFFSKFQWKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPK
  LCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHNKRWRVGVCRDDVDRRKEYVTLSPDH
  GYWVLRLNGEHLYFTLNPRFISVFPRTPPTKIGVFLDYECGTISFFNINDQSLIYTLTCRFEGLLRPYIEYPSYN
  EQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQATTPFLPRGEM

• Structural information:
  • Protein Domains: (19..13-)
    1 (/note="Ig-like-V-type)
    (133..22-)
    2 (/note="Ig-like-V-type)
    (270..46-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR007110  IPR036179   IPR013783  IPR003599  IPR013106  IPR006574  IPR003877  
  • Prosite: PS50188 PS50835
  • STRING: ENSP00000342197
• Other Databases: GeneCards:  BTNL8  Malacards:  BTNL8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050776	regulation of immune response	IBA	biological process
GO:0001817	regulation of cytokine production	IBA	biological process
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray