• Gene id: 79899

Gene Summary

• Gene Symbol: PRR5L   Gene   UCSC   Ensembl
• Aliases: PROTOR2
• Gene name: proline rich 5 like
• Alternate names: proline-rich protein 5-like, Protein observed with Rictor-2, protor-2,
• Gene location: 11p13-p12 (36296287: 36465203)     Exons: 9     NC_000011.10
• OMIM: 611728

Protein Summary

• Protein general information: Q6MZQ0  
  • Name: Proline rich protein 5 like (Protein observed with Rictor 2) (Protor 2)
  • Length: 368  
  • Mass: 40836
• Sequence:

  MTRGFAPILPVEFHKMGSFRRPRPRFMSSPVLSDLPRFQAARQALQLSSSSAWNSVQTAVINVFKGGGLQSNELY
  ALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTLQAIFYPVQGQ
  ELTIRQISLLGFRDLVLLKVKLGDLLLLAQSKLPSSIVQMLLILQSVHEPTGPSESYLQLEELVKQVVSPFLGIS
  GDRSFSGPTYTLARRHSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQ
  LLAMATMMHSGLGEEASSENKCLLLPPSFPPPHRQCSSEPNITDNPDGLEEGARGSQEGSELNCASLS

• Structural information:
  • Interpro: IPR013745  
  • STRING: ENSP00000368144
• Other Databases: GeneCards:  PRR5L  Malacards:  PRR5L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031932	TORC2 complex	IBA	cellular component
GO:0038203	TORC2 signaling	IBA	biological process
GO:0038203	TORC2 signaling	IDA	biological process
GO:0031932	TORC2 complex	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0001933	negative regulation of protein phosphorylation	IMP	biological process
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0090316	positive regulation of intracellular protein transport	IMP	biological process
GO:0010762	regulation of fibroblast migration	IMP	biological process
GO:0061014	positive regulation of mRNA catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0038203	TORC2 signaling	IEA	biological process
GO:0010762	regulation of fibroblast migration	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)