• Gene id: 79886

Gene Summary

• Gene Symbol: CAAP1   Gene   UCSC   Ensembl
• Aliases: C9orf82, CAAP
• Gene name: caspase activity and apoptosis inhibitor 1
• Alternate names: caspase activity and apoptosis inhibitor 1, conserved anti-apoptotic protein,
• Gene location: 9p21.2 (62671782: 62662816)     Exons: 6     NC_000011.10

Protein Summary

• Protein general information: Q9H8G2  
  • Name: Caspase activity and apoptosis inhibitor 1 (Conserved anti apoptotic protein) (CAAP)
  • Length: 361  
  • Mass: 38368
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MTGKKSSREKRRKRSSQEAAAALAAPDIVPALASGSSGSTSGCGSAGGCGSVSCCGNANFSGSVTGGGSGGSCWG
  GSSVERSERRKRRSTDSSSVSGSLQQETKYILPTLEKELFLAEHSDLEEGGLDLTVSLKPVSFYISDKKEMLQQC
  FCIIGEKKLQKMLPDVLKNCSIEEIKKLCQEQLELLSEKKILKILEGDNGMDSDMEEEADDGSKMGSDLVSQQDI
  CIDSASSVRENKQPEGLELKQGKGEDSDVLSINADAYDSDIEGPCNEEAAAPEAPENTVQSEAGQIDDLEKDIEK
  SVNEILGLAESSPNEPKAATLAVPPPEDVQPSAQQLELLELEMRARAIKALMKAGDIKKPA

• Structural information:
  • Interpro: IPR038991  
  • STRING: ENSP00000369431
• Other Databases: GeneCards:  CAAP1  Malacards:  CAAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IBA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)