• Gene id: 79865

Gene Summary

• Gene Symbol: TREML2   Gene   UCSC   Ensembl
• Aliases: C6orf76, TLT-2, TLT2, dJ238O23.1
• Gene name: triggering receptor expressed on myeloid cells like 2
• Alternate names: trem-like transcript 2 protein, triggering receptor expressed on myeloid cells-like protein 2,
• Gene location: 6p21.1 (41201232: 41189748)     Exons: 5     NC_000006.12
• Gene summary(Entrez): TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties (Allcock et al., 2003 [PubMed 12645956]).
• OMIM: 194532

Protein Summary

• Protein general information: Q5T2D2  
  • Name: Trem like transcript 2 protein (TLT 2) (Triggering receptor expressed on myeloid cells like protein 2)
  • Length: 321  
  • Mass: 35127
  • Tissue specificity: Detected in cultured B-cells, T-cell leukemia and monocyte leukemia. Expressed constitutively on CD8 T-cells and induced on CD4 T-cells after activation. {ECO
• Sequence:

  MAPAFLLLLLLWPQGCVSGPSADSVYTKVRLLEGETLSVQCSYKGYKNRVEGKVWCKIRKKKCEPGFARVWVKGP
  RYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMGFQLDVSPAPQTERNIPFTHLDNILKSGTVTTG
  QAPTSGPDAPFTTGVMVFTPGLITLPRLLASTRPASKTGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGP
  ESISTKSGDLSTRSPTTGLCLTSRSLLNRLPSMPSIRHQDVYSTVLGVVLTLLVLMLIMVYGFWKKRHMASYSMC
  SDPSTRDPPGRPEPYVEVYLI

• Structural information:
  • Protein Domains: (20..12-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  
  • Prosite: PS50835
  • STRING: ENSP00000418767
• Other Databases: GeneCards:  TREML2  Malacards:  TREML2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0042110	T cell activation	IBA	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0045088	regulation of innate immune response	IBA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0042110	T cell activation	IDA	biological process
GO:0038023	signaling receptor activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R