• Gene id: 79816

Gene Summary

• Gene Symbol: TLE6   Gene   UCSC   Ensembl
• Aliases: GRG6, PREMBL
• Gene name: TLE family member 6, subcortical maternal complex member
• Alternate names: transducin-like enhancer protein 6, transducin like enhancer of split 6, transducin-like enhancer of split 6 (E(sp1) homolog, Drosophila),
• Gene location: 19p13.3 (2977409: 2995183)     Exons: 21     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the Groucho/ transducin-like Enhancer of split family of transcriptional co-repressors. The encoded protein is a component of the mammalian subcortical maternal complex, which is required for preimplantation development. In m
• OMIM: 617919

Protein Summary

• Protein general information: Q9H808  
  • Name: Transducin like enhancer protein 6
  • Length: 572  
  • Mass: 63473
• Sequence:

  MTSRDQPRPKGPPKSTSPCPGISNSESSPTLNYQGILNRLKQFPRFSPHFAAELESIYYSLHKIQQDVAEHHKQI
  GNVLQIVESCSQLQGFQSEEVSPAEPASPGTPQQVKDKTLQESSFEDIMATRSSDWLRRPLGEDNQPETQLFWDK
  EPWFWHDTLTEQLWRIFAGVHDEKAKPRDRQQAPGLGQESKAPGSCDPGTDPCPEDASTPRPPEASSSPPEGSQD
  RNTSWGVVQEPPGRASRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKMRILAHGELVLATAISSFTRH
  VFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLLTGGYNLASVSVWDLAAPSLHVKEQL
  PCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGYPDGVKSIVVKGYNIWTGGPDACLRCWDQRT
  IMKPLEYQFKSQIMSLSHSPQEDWVLLGMANGQQWLQSTSGSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFL
  GVYSMPAGTKVFEVPEMSPVTCCDVSSNNRLVVTGSGEHASVYQITY

• Structural information:
  • Interpro: IPR009146  IPR015943  IPR001680  IPR017986  IPR036322  
  • Prosite: PS50294
  • STRING: ENSP00000246112
• Other Databases: GeneCards:  TLE6  Malacards:  TLE6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0070491	repressing transcription factor binding	IBA	molecular function
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0032991	protein-containing complex	IMP	cellular component
GO:0060136	embryonic process involved in female pregnancy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Preimplantation embryonic lethality	KEGG:H02335
Preimplantation embryonic lethality	KEGG:H02335
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray