• Gene id: 79815

Gene Summary

• Gene Symbol: NIPAL2   Gene   UCSC   Ensembl
• Aliases: NPAL2
• Gene name: NIPA like domain containing 2
• Alternate names: NIPA-like protein 2,
• Gene location: 8q22.2 (98294234: 98189825)     Exons: 16     NC_000008.11

Protein Summary

• Protein general information: Q9H841  
  • Name: NIPA like protein 2
  • Length: 368  
  • Mass: 40785
• Sequence:

  MAAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGVLLAILGNLVISISLNIQKYSHLQL
  AQQEHPRPYFKSVLWWGGVLLMAVGETGNFAAYGFAPITLIAPLGCVSVTGSAIISVTFLKDNLRASDLLGTTLA
  FAGTYLLVNFAPNITQAISARTVQYYLVGWQFLIYVILEILIFCILLYFYKRKGMKHMVILLTLVAILASLTVIS
  VKAVSGMITFSVMDKMQLTYPIFYIMFIIMIASCVFQVKFLNQATKLYNTTTVVPVNHIFFTISAIIAGIIFYQE
  FLGAPFLTVFIYLFGCFLSFLGVFLVTRNREKEHLQQSYIDFGNIPDTTPERKAWRETNVGQNTTRFT

• Structural information:
  • Interpro: IPR008521  
  • STRING: ENSP00000339256
• Other Databases: GeneCards:  NIPAL2  Malacards:  NIPAL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015693	magnesium ion transport	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0015693	magnesium ion transport	IEA	biological process
GO:0015095	magnesium ion transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:1903830	magnesium ion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray