• Gene id: 79805

Gene Summary

• Gene Symbol: VASH2   Gene   UCSC   Ensembl
• Gene name: vasohibin 2
• Alternate names: tubulinyl-Tyr carboxypeptidase 2, testicular tissue protein Li 222, vasohibin-like protein,
• Gene location: 1q32.3 (212950540: 212991584)     Exons: 8     NC_000001.11
• OMIM: 610471

Protein Summary

• Protein general information: Q86V25  
  • Name: Tubulinyl Tyr carboxypeptidase 2 (EC 3.4.17.17) (Vasohibin 2) (Vasohibin like protein)
  • Length: 355  
  • Mass: 40450
• Sequence:

  MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHP
  KGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMT
  RESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTL
  SDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASA
  HSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI

• Structural information:
  • Interpro: IPR028131  
  • PDB: 6J4O 6J4P 6J4Q 6J4S 6J4V 6QBY
  • PDBsum: 6J4O 6J4P 6J4Q 6J4S 6J4V 6QBY
  • STRING: ENSP00000428324
• Other Databases: GeneCards:  VASH2  Malacards:  VASH2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045765	regulation of angiogenesis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0004181	metallocarboxypeptidase activity	IDA	molecular function
GO:0061564	axon development	IMP	biological process
GO:0004181	metallocarboxypeptidase activity	IMP	molecular function
GO:0004181	metallocarboxypeptidase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0140253	cell-cell fusion	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0140253	cell-cell fusion	IMP	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0060674	placenta blood vessel development	IEA	biological process
GO:0060716	labyrinthine layer blood vessel development	IEA	biological process
GO:0000768	syncytium formation by plasma membrane fusion	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0060711	labyrinthine layer development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq