• Gene id: 79783

Gene Summary

• Gene Symbol: SUGCT   Gene   UCSC   Ensembl
• Aliases: C7orf10, DERP13, GA3, ORF19
• Gene name: succinyl-CoA:glutarate-CoA transferase
• Alternate names: succinate--hydroxymethylglutarate CoA-transferase, Russel-Silver syndrome candidate, dermal papilla-derived protein 13, succinylCoA:glutarate-CoA transferase,
• Gene location: 7p14.1 (40134886: 40860762)     Exons: 21     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that is similar to members of the CaiB/baiF CoA-transferase protein family. Mutations in this gene are associated with glutaric aciduria type III. Alternate splicing results in multiple transcript variants. [provided by RefSeq,
• OMIM: 609187

Protein Summary

• Protein general information: Q9HAC7  
  • Name: Succinate hydroxymethylglutarate CoA transferase (EC 2.8.3.13) (Dermal papilla derived protein 13) (SuccinylCoA:glutarate CoA transferase)
  • Length: 445  
  • Mass: 48462
  • Tissue specificity: Highly expressed in kidney. Intermediate expression in liver, skeletal muscle and pancreas. Little to no expression detected in other tissues examined. {ECO
• Sequence:

  MPSETHAMLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNNIKPLEGVKILDLTRVLAGPFATMNLGDLGAE
  VIKVERPGAGDDTRTWGPPFVGTESTYYLSVNRNKKSIAVNIKDPKGVKIIKELAAVCDVFVENYVPGKLSAMGL
  GYEDIDEIAPHIIYCSITGYGQTGPISQRAGYDAVASAVSGLMHITGPENGDPVRPGVAMTDLATGLYAYGAIMA
  GLIQKYKTGKGLFIDCNLLSSQVACLSHIAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYIVVGAGNNQQFAT
  VCKILDLPELIDNSKYKTNHLRVHNRKELIKILSERFEEELTSKWLYLFEGSGVPYGPINNMKNVFAEPQVLHNG
  LVMEMEHPTVGKISVPGPAVRYSKFKMSEARPPPLLGQHTTHILKEVLRYDDRAIGELLSAGVVDQHETH

• Structural information:
  • Interpro: IPR003673  IPR023606  
  • STRING: ENSP00000338475
• Other Databases: GeneCards:  SUGCT  Malacards:  SUGCT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047369	succinate-hydroxymethylglutarate CoA-transferase activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0008410	CoA-transferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0047369	succinate-hydroxymethylglutarate CoA-transferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Glutaric acidemia	KEGG:H00178
Glutaric acidemia	KEGG:H00178
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq