• Gene id: 79770

Gene Summary

• Gene Symbol: TXNDC15   Gene   UCSC   Ensembl
• Aliases: BUG, C5orf14, UNQ335
• Gene name: thioredoxin domain containing 15
• Alternate names: thioredoxin domain-containing protein 15, 2310047H23Rik, disulfide isomerase,
• Gene location: 5q31.1 (134873769: 134901634)     Exons: 5     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. [provided by RefSeq, Apr 2017]
• OMIM: 617778

Protein Summary

• Protein general information: Q96J42  
  • Name: Thioredoxin domain containing protein 15
  • Length: 360  
  • Mass: 39885
• Sequence:

  MVPAAGRRPPRVMRLLGWWQVLLWVLGLPVRGVEVAEESGRLWSEEQPAHPLQVGAVYLGEEELLHDPMGQDRAA
  EEANAVLGLDTQGDHMVMLSVIPGEAEDKVSSEPSGVTCGAGGAEDSRCNVRESLFSLDGAGAHFPDREEEYYTE
  PEVAESDAAPTEDSNNTESLKSPKVNCEERNITGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPWCRFSAS
  LAPHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAK
  KNVVVTQADQIGPLPSTLIKSVDWLLVFSLFFLISFIMYATIRTESIRWLIPGQEQEHVE

• Structural information:
  • Protein Domains: (153..29-)
    (/note="Thioredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00691"-)
  • Interpro: IPR036249  IPR013766  IPR042418  
  • Prosite: PS51352
  • STRING: ENSP00000351157
• Other Databases: GeneCards:  TXNDC15  Malacards:  TXNDC15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005929	cilium	IBA	cellular component
GO:0060271	cilium assembly	IBA	biological process
GO:0060271	cilium assembly	ISS	biological process
GO:0005929	cilium	ISS	cellular component
GO:0045880	positive regulation of smoothened signaling pathway	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0060271	cilium assembly	IEA	biological process
GO:0060170	ciliary membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray