• Gene id: 79693

Gene Summary

• Gene Symbol: YRDC   Gene   UCSC   Ensembl
• Aliases: DRIP3, IRIP, SUA5
• Gene name: yrdC N6-threonylcarbamoyltransferase domain containing
• Alternate names: yrdC domain-containing protein, mitochondrial, dopamine receptor interacting protein 3, hIRIP, ischemia/reperfusion inducible protein, ischemia/reperfusion-inducible protein homolog, yrdC N(6)-threonylcarbamoyltransferase domain containing, yrdC domain containi,
• Gene location: 1p34.3 (37808207: 37802944)     Exons: 5     NC_000001.11
• OMIM: 612276

Protein Summary

• Protein general information: Q86U90  
  • Name: YrdC domain containing protein, mitochondrial (Dopamine receptor interacting protein 3) (Ischemia/reperfusion inducible protein homolog) (hIRIP)
  • Length: 279  
  • Mass: 29328
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MSPARRCRGMRAAVAASVGLSEGPAGSRSGRLFRPPSPAPAAPGARLLRLPGSGAVQAASPERAGWTEALRAAVA
  ELRAGAVVAVPTDTLYGLACAASCSAALRAVYRLKGRSEAKPLAVCLGRVADVYRYCRVRVPEGLLKDLLPGPVT
  LVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQMFEGPLALTSANLSSQASSLNVEEFQDLWPQLSLVIDGGQ
  IGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLPSHASYL

• Structural information:
  • Protein Domains: (67..25-)
    (/note="YrdC-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00518"-)
  • Interpro: IPR017945  IPR006070  
  • Prosite: PS51163
  • STRING: ENSP00000362135
• Other Databases: GeneCards:  YRDC  Malacards:  YRDC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016779	nucleotidyltransferase activity	IBA	molecular function
GO:0006450	regulation of translational fidelity	IBA	biological process
GO:0000049	tRNA binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051051	negative regulation of transport	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq