• Gene id: 79692

Gene Summary

• Gene Symbol: ZNF322   Gene   UCSC   Ensembl
• Aliases: HCG12, ZNF322A, ZNF388, ZNF489
• Gene name: zinc finger protein 322
• Alternate names: zinc finger protein 322, HLA complex group 12, zinc finger protein 322A, zinc finger protein 388, zinc finger protein 489,
• Gene location: 6p22.2 (26659751: 26634382)     Exons: 5     NC_000006.12
• Gene summary(Entrez): ZNF322A is a member of the zinc-finger transcription factor family and may regulate transcriptional activation in MAPK (see MAPK1; MIM 176948) signaling pathways (Li et al., 2004 [PubMed 15555580]).[supplied by OMIM, Mar 2008]
• OMIM: 610847

Protein Summary

• Protein general information: Q6U7Q0  
  • Name: Zinc finger protein 322 (Zinc finger protein 322A) (Zinc finger protein 388) (Zinc finger protein 489)
  • Length: 402  
  • Mass: 46941
  • Tissue specificity: Ubiquitous. Highly expressed in heart and skeletal muscle. {ECO
• Sequence:

  MYTSEEKCNQRTQKRKIYNVCPRKGKKIFIHMHEIIQIDGHIYQCLECKQNFCENLALIMCERTHTGEKPYKCDM
  CEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHLALSGHQRTHAGKKFYTCDICGKNFGQSSDLLVHQRSHT
  GEKPYLCSECDKCFSRSTNLIRHRRTHTGEKPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYRHRSA
  FIVHKRVHTGEKPYKCGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEK
  SFNCSSDLIVHQRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCDKSFHQSSALLQHQTVHIG
  EKPFVCNVSEKGLELSPPHASEASQMS

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000482607
• Other Databases: GeneCards:  ZNF322  Malacards:  ZNF322

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:1902459	positive regulation of stem cell population maintenance	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)