• Gene id: 79664

Gene Summary

• Gene Symbol: ICE2   Gene   UCSC   Ensembl
• Aliases: BRCC1, NARG2
• Gene name: interactor of little elongation complex ELL subunit 2
• Alternate names: little elongation complex subunit 2, NMDA receptor regulated 2, NMDA receptor-regulated gene 2, NMDA receptor-regulated protein 2, breast cancer cell 1, interactor of little elongator complex ELL subunit 2,
• Gene location: 15q22.2 (32675214: 32597004)     Exons: 30     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein component of the little elongation complex (LEC), which plays a role in small nuclear RNA (snRNA) transcription. The LEC regulates snRNA transcription by enhancing both RNA Polymerase II occupancy and transcriptional elongation
• OMIM: 610835

Protein Summary

• Protein general information: Q659A1  
  • Name: Little elongation complex subunit 2 (Interactor of little elongator complex ELL subunit 2) (NMDA receptor regulated protein 2)
  • Length: 982  
  • Mass: 110011
  • Tissue specificity: Expressed at low levels in lung and testis. {ECO
• Sequence:

  MSSKMVISEPGLNWDISPKNGLKTFFSRENYKDHSMAPSLKELRVLSNRRIGENLNASASSVENEPAVSSATQAK
  EKVKTTIGMVLLPKPRVPYPRFSRFSQREQRSYVDLLVKYAKIPANSKAVGINKNDYLQYLDMKKHVNEEVTEFL
  KFLQNSAKKCAQDYNMLSDDARLFTEKILRACIEQVKKYSEFYTLHEVTSLMGFFPFRVEMGLKLEKTLLALGSV
  KYVKTVFPSMPIKLQLSKDDIATIETSEQTAEAMHYDISKDPNAEKLVSRYHPQIALTSQSLFTLLNNHGPTYKE
  QWEIPVCIQVIPVAGSKPVKVIYINSPLPQKKMTMRERNQIFHEVPLKFMMSKNTSVPVSAVFMDKPEEFISEMD
  MSCEVNECRKIESLENLYLDFDDDVTELETFGVTTTKVSKSPSPASTSTVPNMTDAPTAPKAGTTTVAPSAPDIS
  ANSRSLSQILMEQLQKEKQLVTGMDGGPEECKNKDDQGFESCEKVSNSDKPLIQDSDLKTSDALQLENSQEIETS
  NKNDMTIDILHADGERPNVLENLDNSKEKTVGSEAAKTEDTVLCSSDTDEECLIIDTECKNNSDGKTAVVGSNLS
  SRPASPNSSSGQASVGNQTNTACSPEESCVLKKPIKRVYKKFDPVGEILKMQDELLKPISRKVPELPLMNLENSK
  QPSVSEQLSGPSDSSSWPKSGWPSAFQKPKGRLPYELQDYVEDTSEYLAPQEGNFVYKLFSLQDLLLLVRCSVQR
  IETRPRSKKRKKIRRQFPVYVLPKVEYQACYGVEALTESELCRLWTESLLHSNSSFYVGHIDAFTSKLFLLEEIT
  SEELKEKLSALKISNLFNILQHILKKLSSLQEGSYLLSHAAEDSSLLIYKASDGKVTRTAYNLYKTHCGLPGVPS
  SLSVPWVPLDPSLLLPYHIHHGRIPCTFPPKSLDTTTQQKIGGTRMPTRSHRNPVSMETKSSCLPAQQVETEGVA
  PHKRKIT

• Structural information:
  • Interpro: IPR019535  
  • STRING: ENSP00000261520
• Other Databases: GeneCards:  ICE2  Malacards:  ICE2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042795	snRNA transcription by RNA polymerase II	IBA	biological process
GO:0042796	snRNA transcription by RNA polymerase III	IBA	biological process
GO:0045945	positive regulation of transcription by RNA polymerase III	IBA	biological process
GO:0035327	transcriptionally active chromatin	IDA	cellular component
GO:0035327	transcriptionally active chromatin	IDA	cellular component
GO:0035363	histone locus body	IDA	cellular component
GO:0008023	transcription elongation factor complex	IDA	cellular component
GO:0015030	Cajal body	IDA	cellular component
GO:0008023	transcription elongation factor complex	IMP	cellular component
GO:0042796	snRNA transcription by RNA polymerase III	IMP	biological process
GO:0045945	positive regulation of transcription by RNA polymerase III	IMP	biological process
GO:0042795	snRNA transcription by RNA polymerase II	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008023	transcription elongation factor complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq